Sex pheromone biosynthesis is induced in many moths by a neuropeptide, PBAN, consisting of 33-amino acid amidated at the C-terminus. The present study is concerned with cloning and characterizing the partial sequence of Hea-PBAN cDNA whichis isolated from the brain and suboesophageal ganglion complex(Br-Sg) of Helicoverpa armigera adults. From the cDNA sequence, it can be predicted that the cDNA has a PBAN domain with 33 amino acids, LSDDM-PATPADQEMYRQDPEQIDSRTKYFSPRL, with FSPRL at the C-terminus. The amino acid sequence of predicted peptides including the PBAN, is identical to that of H.zea and H.assulta.